PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 285aa    MW: 30440.8 Da    PI: 5.2246
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05414genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-152269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++++G  tW+++a+  g++R++k+c++rw +yl
         EMT05414 22 KGLWSPEEDERLYIRITRHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69
                     678*******************************************97 PP

2Myb_DNA-binding43.29.3e-1477117345
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + ++ E+e ++ + k lG++ W+ Ia++m+ gRt++++k++w+
         EMT05414  77 PISKREEETIISLQKSLGNR-WSVIAAKMP-GRTDNEIKNYWN 117
                      56889***************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.1131773IPR017930Myb domain
SMARTSM007171.3E-102171IPR001005SANT/Myb domain
SuperFamilySSF466891.64E-2721116IPR009057Homeodomain-like
PfamPF002492.0E-132269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-202376IPR009057Homeodomain-like
CDDcd001671.81E-92569No hitNo description
PROSITE profilePS5129416.54574124IPR017930Myb domain
SMARTSM007174.9E-1374122IPR001005SANT/Myb domain
CDDcd001671.97E-1077117No hitNo description
PfamPF002491.3E-1177118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-2277123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MVEKPASQAD VGGEVEAHKE RKGLWSPEED ERLYIRITRH GVSTWSSVAQ LAGLRRSGKS  60
CRLRWMNYLR PDLKKEPISK REEETIISLQ KSLGNRWSVI AAKMPGRTDN EIKNYWNSRI  120
RKRQTISTGG GKGDSGLAKQ QGDLPAADDK AAVLAPPGEK ELVSSMATGA AAPPVPARFP  180
LFACQLLGGG GGGGGDAAIA AAGTTESTTT HENNGAGSES DVSVGNGGGQ DGREGHYYYC  240
AVDGDIDMVH LMSFDDLLEY PAGDLLMDAW DQNGLYSTNT GNSVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-242212327127MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.11e-103PREDICTED: myb-related protein Myb4
TrEMBLM8AVG60.0M8AVG6_AEGTA; Myb-related protein Hv33
STRINGMLOC_19052.11e-168(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.12e-46myb domain protein 86